PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10013213m
Common NameCARUB_v10013213mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family EIL
Protein Properties Length: 628aa    MW: 71033 Da    PI: 5.7799
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10013213mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN34992.4e-152494221354
                      XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
             EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraW 94 
                      +el++rmw+d+m+lkrlke+ k+    ke  ++a+k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipe+gkpv+gasd+Lr+W
  Carubv10013213m  49 DELERRMWRDKMRLKRLKEQDKS----KEG-VDAAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPENGKPVTGASDNLREW 137
                      79*******************98....777.9************************************************************** PP

                      XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--T CS
             EIN3  95 WkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglsk 188
                      Wk+kv+fdrngpaai+kyqa+n+i++ +++++     ++h+l+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWP+Gke+ww++lgl+k
  Carubv10013213m 138 WKDKVRFDRNGPAAITKYQAENNIPGIHEGNNP-IGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVPPPWWPNGKEDWWPQLGLPK 230
                      **************************9999977.9*********************************************************** PP

                      T--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX...XXXXXXXXXXXXXX CS
             EIN3 189 dqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss...slrkqspkvtlsce 279
                      dqg+ pykkphdlkkawkv+vLtavikhm p+i++ir+l+rqsk+lqdkm+akes+++l+++nqee+++++++++s    +l+ +s ++ +++ 
  Carubv10013213m 231 DQGPAPYKKPHDLKKAWKVGVLTAVIKHMFPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEESLARELYPESCppiTLSGGSCSLLMNDC 324
                      ***************************************************************************444578888********** PP

                      XXXXXX.XXXXXX.XXXXXXXXXX.........................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXX CS
             EIN3 280 qkedve.gkkeskikhvqavktta.........................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadkn 347
                      +++dve  +ke++   v++ k ++                         + +++rkrk +++ ++ +  + ++ tc++  + +se + +f d+n
  Carubv10013213m 325 SQYDVEgFEKEPH-YGVEELKPEKvmtssnfgmaakihdfpvkeevptgNSEFIRKRKPNRDLNTVMD-R-TVFTCENLGCVHSEISRGFLDRN 415
                      ******6566666.7788888888899******************************95555555554.4.47********************* PP

                      XXXXXXX CS
             EIN3 348 sisqney 354
                      s++++++
  Carubv10013213m 416 SRDNHQM 422
                      *****96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048736.7E-12949296No hitNo description
Gene3DG3DSA:1.10.3180.107.8E-75170306IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167682.75E-60175299IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009873Biological Processethylene-activated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 628 aa     Download sequence    Send to blast
MMFNEIGMCG NMDFFSSGSL GEVDFCPAPQ AEPDSIVEDD YTDDEIDVDE LERRMWRDKM  60
RLKRLKEQDK SKEGVDAAKQ RQSQEQARRK KMSRAQDGIL KYMLKMMEVC KAQGFVYGII  120
PENGKPVTGA SDNLREWWKD KVRFDRNGPA AITKYQAENN IPGIHEGNNP IGPTPHTLQE  180
LQDTTLGSLL SALMQHCDPP QRRFPLEKGV PPPWWPNGKE DWWPQLGLPK DQGPAPYKKP  240
HDLKKAWKVG VLTAVIKHMF PDIAKIRKLV RQSKCLQDKM TAKESATWLA IINQEESLAR  300
ELYPESCPPI TLSGGSCSLL MNDCSQYDVE GFEKEPHYGV EELKPEKVMT SSNFGMAAKI  360
HDFPVKEEVP TGNSEFIRKR KPNRDLNTVM DRTVFTCENL GCVHSEISRG FLDRNSRDNH  420
QMGCPHRDSC LPYGAAASRF HVNEVKPVVG FSQPRPVNSV AQPIDLTGMG VPEDGQKMIS  480
ELMSMYDRNV QSNQTSVVME SQSVSLLQPT IQNHQEQLQF PGNMVEGSFF EDLNIPNRAN  540
NNNSSNQTFF QGNNNNGFKF DTAHHNNFEA AHNNNNNNSS SNRFQLVFDS TPFDMASFDY  600
RDDMSMPGVV GTMDGMQQKQ QDVSIWF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A3e-921743062134Protein ETHYLENE INSENSITIVE 3
4zds_B3e-921743062134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00367DAPTransfer from AT3G20770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0256290.0AB025629.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MOE17.
GenBankAF0042160.0AF004216.1 Arabidopsis thaliana ethylene-insensitive3 (EIN3) mRNA, complete cds.
GenBankAF0042170.0AF004217.1 Arabidopsis thaliana ethylene-insensitive3 (EIN3) gene, complete cds.
GenBankAY0698750.0AY069875.2 Arabidopsis thaliana AT3g20770/MOE17_6 mRNA, complete cds.
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006297205.10.0hypothetical protein CARUB_v10013213mg
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLR0I1810.0R0I181_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.3__2304__AT3G20770.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21352879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein